20% OFF shipping at randomsongs.org on orders over $79 + up to 10% OFF products
randomsongs.org
home > CD267 Recombinant Protein - NCP0339 > CD267 Recombinant Protein - NCP0339
download picture
CD267 Recombinant Protein - NCP0339CD267 Recombinant Protein Catalogue Number: NCP0339 500, NCP0339 1000 Sizes: 500ug, 1mg Swiss Prot: O14836 Host: E. coli Tag: His tag AA Sequence: MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS Restriction Sites: NdeI XhoI Background: Transmembrane activator and calcium modulating cyclophilin ligand interactor (TACI), also known as
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

CD267 Recombinant Protein

Catalogue Number: NCP0339-500, NCP0339-1000

Sizes: 500ug, 1mg

Swiss-Prot: O14836

Host: E.coli

Tag: His-tag

AA Sequence: MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS

Restriction Sites: NdeI-XhoI

Background: Transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI), also known as tumor necrosis factor receptor superfamily member 13B (TNFRSF13B) and cluster of differentiation 267 (CD267), is a single-pass type III membrane receptor that is highly expressed on the surface of mature innate-like B cells, such as marginal zone and B-1 B cells in mice, and memory B cells in humans. TACI/TNFRSF13B/CD267 is also expressed on the surface of activated T cells, while monocytes and dendritic cells express lower levels of TACI/TNFRSF13B/CD267 primarily intracellularly. TACI/TNFRSF13B/CD267 is the receptor for soluble ligands BAFF/TNFSF13B and APRIL/TNFSF13. Upon ligation, TACI/TNFRSF13B/CD267 recruits tumor necrosis factor receptor–associated factor (TRAF) family members and calcium signal-modulating cyclophilin ligand (CAMLG) in order to activate NFAT, NF-κB, and AP-1 transcriptional programs. TACI/TNFRSF13B/CD267 is necessary for T cell-independent type II and type I responses, negative regulation of B cell and T follicular helper cell numbers, and promotion of class switch recombination in B cells. Mutations and aberrant regulation of TACI/TNFRSF13B/CD267 has been associated with cancer, autoimmune diseases, and immunodeficiency disorders. Multiple isoforms produced by alternative splicing have been identified.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~22kDa

Notes: For research use only, not for use in diagnostic procedure.

CD267 Recombinant Protein - NCP0339

Item no : 35675532781
sold recently : Login >>
US$ 525.41
Pay in 4 interest-free payments of $131.35 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jun 25 - Jun 30

Enjoy 20% off shipping

US$ 525.41

1-11

US$ 472.87

12-35

US$ 367.79

36-59

US$ 315.25

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches